Lineage for d2ghod1 (2gho D:3-1501)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885463Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 885464Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 885531Family e.29.1.2: RNA-polymerase beta-prime [64490] (2 proteins)
  6. 885559Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 885560Species Thermus aquaticus [TaxId:271] [64494] (4 PDB entries)
  8. 885564Domain d2ghod1: 2gho D:3-1501 [145197]
    Other proteins in same PDB: d2ghoa1, d2ghoa2, d2ghob1, d2ghob2, d2ghoc1

Details for d2ghod1

PDB Entry: 2gho (more details), 5 Å

PDB Description: recombinant thermus aquaticus rna polymerase for structural studies
PDB Compounds: (D:) DNA-directed RNA polymerase beta' chain

SCOP Domain Sequences for d2ghod1:

Sequence, based on SEQRES records: (download)

>d2ghod1 e.29.1.2 (D:3-1501) RNA-polymerase beta-prime {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfnkyivldpkgavldgvpvekrqlltdeeyggidarmgaeaiqellkeldlekl
erelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtn
pgserplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagre
tsvgrlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgde
kvaqeliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigidd
avipeekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlr
lrkrsdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtdit
qglprvielfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllv
kdgdyveagqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvr
qmlkyvevtdpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstks
wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlk
aieearke

Sequence, based on observed residues (ATOM records): (download)

>d2ghod1 e.29.1.2 (D:3-1501) RNA-polymerase beta-prime {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfnkyivldpkgavldgvpvekrqlltdeeyggidarmgaeaiqellkeldlekl
erelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtn
pgserplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagre
tsvgrlkfvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgde
kvaqeliqmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigidd
avipeekqryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlr
lrkrsdiesglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgvvaaesigepgtqltmrttqglprvielfea
rrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpl
trgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpg
dsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasfqntth
vlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieearke

SCOP Domain Coordinates for d2ghod1:

Click to download the PDB-style file with coordinates for d2ghod1.
(The format of our PDB-style files is described here.)

Timeline for d2ghod1: