![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (10 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [187748] (1 PDB entry) |
![]() | Domain d2ge3c_: 2ge3 C: [135046] Other proteins in same PDB: d2ge3a1 automated match to d2ge3a1 complexed with aco |
PDB Entry: 2ge3 (more details), 2.25 Å
SCOPe Domain Sequences for d2ge3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ge3c_ d.108.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 358]} dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels vhadnaraialyekigfahegrardavsidghyidslnmaiifg
Timeline for d2ge3c_: