SCOPe 2.08: Domain d2ge3c_: 2ge3 C:

Lineage for d2ge3c_ (2ge3 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein automated matches [190241] (13 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:358] [187748] (1 PDB entry)

8. Domain d2ge3c_: 2ge3 C: [135046]
   Other proteins in same PDB: d2ge3a1
   automated match to d2ge3a1
   complexed with aco

Details for d2ge3c_

PDB Entry: 2ge3, 2.25 Å

PDB Description: Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens

PDB Compounds: (C:) Probable acetyltransferase

SCOPe Domain Sequences for d2ge3c_:

Sequence; same for both SEQRES and ATOM records:

>d2ge3c_ d.108.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia
dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels
vhadnaraialyekigfahegrardavsidghyidslnmaiifg

Timeline for d2ge3c_:

• d2ge3c_ first appeared in SCOP 1.73, called d2ge3c1
  
• d2ge3c_ appears in SCOPe 2.07