Lineage for d2ge3c_ (2ge3 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533562Protein automated matches [190241] (12 species)
    not a true protein
  7. 2533563Species Agrobacterium tumefaciens [TaxId:358] [187748] (1 PDB entry)
  8. 2533565Domain d2ge3c_: 2ge3 C: [135046]
    Other proteins in same PDB: d2ge3a1
    automated match to d2ge3a1
    complexed with aco

Details for d2ge3c_

PDB Entry: 2ge3 (more details), 2.25 Å

PDB Description: Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
PDB Compounds: (C:) Probable acetyltransferase

SCOPe Domain Sequences for d2ge3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ge3c_ d.108.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia
dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels
vhadnaraialyekigfahegrardavsidghyidslnmaiifg

SCOPe Domain Coordinates for d2ge3c_:

Click to download the PDB-style file with coordinates for d2ge3c_.
(The format of our PDB-style files is described here.)

Timeline for d2ge3c_: