SCOPe 2.01: Domain d2gcaa1: 2gca A:297-425

Lineage for d2gcaa1 (2gca A:297-425)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)

6. Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)

7. Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries)

8. Domain d2gcaa1: 2gca A:297-425 [134973]
   Other proteins in same PDB: d2gcaa2
   automatically matched to d1fgs_1

Details for d2gcaa1

PDB Entry: 2gca, 2.4 Å

PDB Description: apo form of l. casei fpgs

PDB Compounds: (A:) Folylpolyglutamate synthase

SCOPe Domain Sequences for d2gcaa1:

Sequence, based on SEQRES records:

>d2gcaa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg

Sequence, based on observed residues (ATOM records):

>d2gcaa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagilyaamadrltaafs
tvylvpvpgtpralrlkdswqealaaslndvpdqpivitgslylasavrqtllg

Timeline for d2gcaa1:

• d2gcaa1 first appeared in SCOP 1.73
  
• d2gcaa1 appears in SCOP 1.75
  
• d2gcaa1 appears in SCOPe 2.02
  
• d2gcaa1 appears in the current release, SCOPe 2.08