Lineage for d2gcaa1 (2gca A:297-425)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838806Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 838807Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 838842Family c.59.1.2: Folylpolyglutamate synthetase, C-terminal domain [53250] (1 protein)
  6. 838843Protein Folylpolyglutamate synthetase, C-terminal domain [53251] (2 species)
  7. 838844Species Lactobacillus casei [TaxId:1582] [53252] (7 PDB entries)
  8. 838850Domain d2gcaa1: 2gca A:297-425 [134973]
    Other proteins in same PDB: d2gcaa2
    automatically matched to d1fgs_1

Details for d2gcaa1

PDB Entry: 2gca (more details), 2.4 Å

PDB Description: apo form of l. casei fpgs
PDB Compounds: (A:) Folylpolyglutamate synthase

SCOP Domain Sequences for d2gcaa1:

Sequence, based on SEQRES records: (download)

>d2gcaa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrlt
aafstvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslyla
savrqtllg

Sequence, based on observed residues (ATOM records): (download)

>d2gcaa1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]}
wparlekisdtplividgahnpdginglitalkqlfsqpitviagilyaamadrltaafs
tvylvpvpgtpralrlkdswqealaaslndvpdqpivitgslylasavrqtllg

SCOP Domain Coordinates for d2gcaa1:

Click to download the PDB-style file with coordinates for d2gcaa1.
(The format of our PDB-style files is described here.)

Timeline for d2gcaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gcaa2