Lineage for d2ga5a1 (2ga5 A:2-123)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527817Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2527818Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 2527819Protein C-terminal domain of frataxin [55389] (2 species)
    protein responsible for Friedreich ataxia
  7. 2527820Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries)
    Uniprot Q07540 52-174! Uniprot Q07540 61-172
  8. 2527825Domain d2ga5a1: 2ga5 A:2-123 [134860]
    Other proteins in same PDB: d2ga5a2

Details for d2ga5a1

PDB Entry: 2ga5 (more details)

PDB Description: yeast frataxin
PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOPe Domain Sequences for d2ga5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga5a1 d.82.2.1 (A:2-123) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esstdgqvvpqevlnlplekyheeaddyldhlldsleelseahpdcipdvelshgvmtle
ipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk
sq

SCOPe Domain Coordinates for d2ga5a1:

Click to download the PDB-style file with coordinates for d2ga5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ga5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ga5a2