SCOPe 2.08: Domain d2ga5a1: 2ga5 A:2-123

Lineage for d2ga5a1 (2ga5 A:2-123)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.1: Frataxin-like [55388] (3 proteins)
   iron homeostasis proteins
   automatically mapped to Pfam PF01491

6. Protein C-terminal domain of frataxin [55389] (2 species)
   protein responsible for Friedreich ataxia

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries)
   Uniprot Q07540 52-174! Uniprot Q07540 61-172

8. Domain d2ga5a1: 2ga5 A:2-123 [134860]
   Other proteins in same PDB: d2ga5a2

Details for d2ga5a1

PDB Entry: 2ga5

PDB Description: yeast frataxin

PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOPe Domain Sequences for d2ga5a1:

Sequence; same for both SEQRES and ATOM records:

>d2ga5a1 d.82.2.1 (A:2-123) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esstdgqvvpqevlnlplekyheeaddyldhlldsleelseahpdcipdvelshgvmtle
ipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk
sq

Timeline for d2ga5a1:

• d2ga5a1 first appeared in SCOP 1.73
  
• d2ga5a1 appears in SCOPe 2.07