PDB entry 2ga5

View 2ga5 on RCSB PDB site
Description: yeast frataxin
Class: Chaperone
Keywords: Yfh1, Chaperone
Deposited on 2006-03-07, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frataxin homolog, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07540 (1-122)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2ga5a1, d2ga5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ga5A (A:)
messtdgqvvpqevlnlplekyheeaddyldhlldsleelseahpdcipdvelshgvmtl
eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
ksq