Lineage for d2ga5a1 (2ga5 A:1-123)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728433Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 728460Superfamily d.82.2: Frataxin/Nqo15-like [55387] (2 families) (S)
  5. 728461Family d.82.2.1: Frataxin-like [55388] (2 proteins)
    iron homeostasis proteins
  6. 728462Protein C-terminal domain of frataxin [55389] (2 species)
    protein responsible for Friedreich ataxia
  7. 728463Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (2 PDB entries)
  8. 728465Domain d2ga5a1: 2ga5 A:1-123 [134860]

Details for d2ga5a1

PDB Entry: 2ga5 (more details)

PDB Description: yeast frataxin
PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOP Domain Sequences for d2ga5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga5a1 d.82.2.1 (A:1-123) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
messtdgqvvpqevlnlplekyheeaddyldhlldsleelseahpdcipdvelshgvmtl
eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
ksq

SCOP Domain Coordinates for d2ga5a1:

Click to download the PDB-style file with coordinates for d2ga5a1.
(The format of our PDB-style files is described here.)

Timeline for d2ga5a1: