Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.50: AF1104-like [111320] (1 superfamily) 2 domains; d1: [all-alpha; 3-helical bundle, similar to the immunoglobulin/albumin-binding domain-like fold (46996)]; d2: [alpha/beta; 3 layers, a/b/a; 6-stranded mixed beta-sheet, order: 321456, strand 6 is antiparallel to the rest] |
Superfamily e.50.1: AF1104-like [111321] (1 family) automatically mapped to Pfam PF01937 |
Family e.50.1.1: AF1104-like [111322] (3 proteins) Pfam PF01937 |
Protein Hypothetical protein PH1575 [144049] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [144050] (1 PDB entry) Uniprot O59272 1-284 |
Domain d2g8la1: 2g8l A:1-284 [134775] Other proteins in same PDB: d2g8la2 complexed with edo, unl |
PDB Entry: 2g8l (more details), 2.04 Å
SCOPe Domain Sequences for d2g8la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8la1 e.50.1.1 (A:1-284) Hypothetical protein PH1575 {Pyrococcus horikoshii [TaxId: 53953]} mkvqyecltcmanqcqrivematqdmdirrramilaakllakeynenaipaiagslifle lykflgnddpfieyklkseemarkvadiikrklkldfelavklaiignvidfsvgfsped leeevekmlkdklyiddskelfeevkraenilyitdnvgehyfdailiekireisnaevy iagkegpiindatvedlkragleklgkvistgtrivgvplklvsrefmeafnkadviiak gqgnfetlseindsriffllkakcpavarelkvpkgalvcmrnk
Timeline for d2g8la1: