SCOPe 2.08: Domain d2g8la1: 2g8l A:1-284

Lineage for d2g8la1 (2g8l A:1-284)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.50: AF1104-like [111320] (1 superfamily)
   2 domains; d1: [all-alpha; 3-helical bundle, similar to the immunoglobulin/albumin-binding domain-like fold (46996)]; d2: [alpha/beta; 3 layers, a/b/a; 6-stranded mixed beta-sheet, order: 321456, strand 6 is antiparallel to the rest]

4. Superfamily e.50.1: AF1104-like [111321] (1 family)
   automatically mapped to Pfam PF01937

5. Family e.50.1.1: AF1104-like [111322] (3 proteins)
   Pfam PF01937

6. Protein Hypothetical protein PH1575 [144049] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [144050] (1 PDB entry)
   Uniprot O59272 1-284

8. Domain d2g8la1: 2g8l A:1-284 [134775]
   Other proteins in same PDB: d2g8la2
   complexed with edo, unl

Details for d2g8la1

PDB Entry: 2g8l, 2.04 Å

PDB Description: crystal structure of a duf89 family protein (ph1575) from pyrococcus horikoshii at 2.04 a resolution

PDB Compounds: (A:) 287aa long hypothetical protein

SCOPe Domain Sequences for d2g8la1:

Sequence; same for both SEQRES and ATOM records:

>d2g8la1 e.50.1.1 (A:1-284) Hypothetical protein PH1575 {Pyrococcus horikoshii [TaxId: 53953]}
mkvqyecltcmanqcqrivematqdmdirrramilaakllakeynenaipaiagslifle
lykflgnddpfieyklkseemarkvadiikrklkldfelavklaiignvidfsvgfsped
leeevekmlkdklyiddskelfeevkraenilyitdnvgehyfdailiekireisnaevy
iagkegpiindatvedlkragleklgkvistgtrivgvplklvsrefmeafnkadviiak
gqgnfetlseindsriffllkakcpavarelkvpkgalvcmrnk

Timeline for d2g8la1:

• d2g8la1 first appeared in SCOP 1.73
  
• d2g8la1 appears in SCOPe 2.07