![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein Putative deaminase NE0047 [142833] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries) Uniprot Q82Y41 1-189 |
![]() | Domain d2g84a1: 2g84 A:1-189 [134766] Other proteins in same PDB: d2g84b2 complexed with bme, edo, na, zn |
PDB Entry: 2g84 (more details), 1.4 Å
SCOPe Domain Sequences for d2g84a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]} mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac ngviynarc
Timeline for d2g84a1: