Lineage for d2g84a1 (2g84 A:1-189)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711877Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 711878Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 711934Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
    strand 5 is parallel to strand 4
  6. 711962Protein Putative deaminase NE0047 [142833] (1 species)
  7. 711963Species Nitrosomonas europaea [TaxId:915] [142834] (1 PDB entry)
  8. 711964Domain d2g84a1: 2g84 A:1-189 [134766]
    complexed with bme, edo, na, zn

Details for d2g84a1

PDB Entry: 2g84 (more details), 1.4 Å

PDB Description: cytidine and deoxycytidylate deaminase zinc-binding region from nitrosomonas europaea.
PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOP Domain Sequences for d2g84a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac
ngviynarc

SCOP Domain Coordinates for d2g84a1:

Click to download the PDB-style file with coordinates for d2g84a1.
(The format of our PDB-style files is described here.)

Timeline for d2g84a1: