Lineage for d2g84a1 (2g84 A:1-189)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525818Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2525849Protein Putative deaminase NE0047 [142833] (1 species)
  7. 2525850Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries)
    Uniprot Q82Y41 1-189
  8. 2525851Domain d2g84a1: 2g84 A:1-189 [134766]
    Other proteins in same PDB: d2g84b2
    complexed with bme, edo, na, zn

Details for d2g84a1

PDB Entry: 2g84 (more details), 1.4 Å

PDB Description: cytidine and deoxycytidylate deaminase zinc-binding region from nitrosomonas europaea.
PDB Compounds: (A:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d2g84a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac
ngviynarc

SCOPe Domain Coordinates for d2g84a1:

Click to download the PDB-style file with coordinates for d2g84a1.
(The format of our PDB-style files is described here.)

Timeline for d2g84a1: