Lineage for d2g7ga1 (2g7g A:9-73)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981994Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1982182Protein Putative transcriptional regulator Rha04620 [140195] (1 species)
  7. 1982183Species Rhodococcus sp. RHA1 [TaxId:101510] [140196] (1 PDB entry)
  8. 1982184Domain d2g7ga1: 2g7g A:9-73 [134732]
    Other proteins in same PDB: d2g7ga2
    complexed with acy

Details for d2g7ga1

PDB Entry: 2g7g (more details), 2.01 Å

PDB Description: The Crystal Structure of the Putative Transcriptional Regulator Rha04620 from Rhodococcus sp. RHA1
PDB Compounds: (A:) Rha04620, Putative Transcriptional Regulator

SCOPe Domain Sequences for d2g7ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. RHA1 [TaxId: 101510]}
ldreriaeaalelvdrdgdfrmpdlarhlnvqvssiyhhakgraavvelvrhrvvreidg
safer

SCOPe Domain Coordinates for d2g7ga1:

Click to download the PDB-style file with coordinates for d2g7ga1.
(The format of our PDB-style files is described here.)

Timeline for d2g7ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7ga2