![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative transcriptional regulator Rha04620 [140195] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [140196] (1 PDB entry) |
![]() | Domain d2g7ga1: 2g7g A:9-73 [134732] Other proteins in same PDB: d2g7ga2 complexed with acy |
PDB Entry: 2g7g (more details), 2.01 Å
SCOPe Domain Sequences for d2g7ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. RHA1 [TaxId: 101510]} ldreriaeaalelvdrdgdfrmpdlarhlnvqvssiyhhakgraavvelvrhrvvreidg safer
Timeline for d2g7ga1: