SCOPe 2.01: Domain d2g5hc_: 2g5h C:

Lineage for d2g5hc_ (2g5h C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
   Uniprot P68807 2-100

8. Domain d2g5hc_: 2g5h C: [134661]
   Other proteins in same PDB: d2g5ha_, d2g5hb1, d2g5hb2
   automated match to d2df4c1
   protein/RNA complex; complexed with mg

Details for d2g5hc_

PDB Entry: 2g5h, 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2g5hc_:

Sequence; same for both SEQRES and ATOM records:

>d2g5hc_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
tkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqn
vlredkaikgipqelalknaketedgqfkvptimneeda

Timeline for d2g5hc_:

• d2g5hc_ first appeared in SCOP 1.73, called d2g5hc1
  
• d2g5hc_ was called d2g5hc1 in SCOP 1.75
  
• d2g5hc_ appears in SCOPe 2.02
  
• d2g5hc_ appears in the current release, SCOPe 2.08