SCOP 1.73: Domain d2g5hc1: 2g5h C:2-100

Lineage for d2g5hc1 (2g5h C:2-100)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)

8. Domain d2g5hc1: 2g5h C:2-100 [134661]
   Other proteins in same PDB: d2g5ha1, d2g5hb1, d2g5hb2
   automatically matched to 2DF4 C:2-100
   complexed with mg

Details for d2g5hc1

PDB Entry: 2g5h, 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOP Domain Sequences for d2g5hc1:

Sequence; same for both SEQRES and ATOM records:

>d2g5hc1 a.137.12.1 (C:2-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
tkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqn
vlredkaikgipqelalknaketedgqfkvptimneeda

Timeline for d2g5hc1:

• d2g5hc1 is new in SCOP 1.73
  
• d2g5hc1 appears in SCOP 1.75
  
• d2g5hc1 appears in the current release, SCOPe 2.08, called d2g5hc_