Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries) |
Domain d2g51a_: 2g51 A: [134642] automated match to d1fn8a_ complexed with cl |
PDB Entry: 2g51 (more details), 1.84 Å
SCOPe Domain Sequences for d2g51a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g51a_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]} ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
Timeline for d2g51a_: