PDB entry 2g51

View 2g51 on RCSB PDB site
Description: anomalous substructure of trypsin (p1)
Class: hydrolase
Keywords: anomalous substructure of trypsin (p1), HYDROLASE
Deposited on 2006-02-22, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g51a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g51A (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya