Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.1: Pyruvate kinase [51622] (1 protein) |
Protein Pyruvate kinase, N-terminal domain [51623] (6 species) this domain is interrupted by an all-beta domain C-terminal domain is alpha/beta |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries) |
Domain d2g50f2: 2g50 F:12-115,F:218-395 [134634] Other proteins in same PDB: d2g50a1, d2g50a3, d2g50b1, d2g50b3, d2g50c1, d2g50c3, d2g50d1, d2g50d3, d2g50e1, d2g50e3, d2g50f1, d2g50f3, d2g50g1, d2g50g3, d2g50h1, d2g50h3 automatically matched to d1a49a2 complexed with ala, edo, ete, gol, k, mn, na, pyr |
PDB Entry: 2g50 (more details), 1.65 Å
SCOPe Domain Sequences for d2g50f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g50f2 c.1.12.1 (F:12-115,F:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} iqtqqlhaamadtflehkcrldidsapitarntgiictigpasrsvetlkemiksgmnva rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe
Timeline for d2g50f2: