Lineage for d2g50e1 (2g50 E:116-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804114Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries)
  8. 2804119Domain d2g50e1: 2g50 E:116-217 [134630]
    Other proteins in same PDB: d2g50a2, d2g50a3, d2g50b2, d2g50b3, d2g50c2, d2g50c3, d2g50d2, d2g50d3, d2g50e2, d2g50e3, d2g50f2, d2g50f3, d2g50g2, d2g50g3, d2g50h2, d2g50h3
    automatically matched to d1a49a1
    complexed with ala, edo, ete, gol, k, mn, na, pyr

Details for d2g50e1

PDB Entry: 2g50 (more details), 1.65 Å

PDB Description: the location of the allosteric amino acid binding site of muscle pyruvate kinase.
PDB Compounds: (E:) Pyruvate kinase isozymes M1/M2

SCOPe Domain Sequences for d2g50e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g50e1 b.58.1.1 (E:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOPe Domain Coordinates for d2g50e1:

Click to download the PDB-style file with coordinates for d2g50e1.
(The format of our PDB-style files is described here.)

Timeline for d2g50e1: