SCOP 1.73: Domain d2g4cb1: 2g4c B:369-485

Lineage for d2g4cb1 (2g4c B:369-485)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain [64073] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142419] (1 PDB entry)

8. Domain d2g4cb1: 2g4c B:369-485 [134584]
   Other proteins in same PDB: d2g4ca2, d2g4cb2, d2g4cc2, d2g4cd2
   automatically matched to 2G4C A:369-485

Details for d2g4cb1

PDB Entry: 2g4c, 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit

PDB Compounds: (B:) DNA polymerase gamma subunit 2

SCOP Domain Sequences for d2g4cb1:

Sequence; same for both SEQRES and ATOM records:

>d2g4cb1 c.51.1.1 (B:369-485) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rkvlklhpclapikvaldvgrgptlelrqvcqglfnellengisvwpgyletmqssleql
yskydemsilftvlvtettlenglihlrsrdttmkemmhisklkdflikyissaknv

Timeline for d2g4cb1:

• d2g4cb1 is new in SCOP 1.73
  
• d2g4cb1 appears in SCOP 1.75
  
• d2g4cb1 appears in the current release, SCOPe 2.08