Lineage for d2g4cd2 (2g4c D:67-355)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730673Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 730844Protein The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain [64349] (2 species)
  7. 730845Species Human (Homo sapiens) [TaxId:9606] [143638] (1 PDB entry)
  8. 730849Domain d2g4cd2: 2g4c D:67-355 [134589]
    Other proteins in same PDB: d2g4ca1, d2g4cb1, d2g4cc1, d2g4cd1
    automatically matched to 2G4C A:66-355

Details for d2g4cd2

PDB Entry: 2g4c (more details), 3.15 Å

PDB Description: crystal structure of human dna polymerase gamma accessory subunit
PDB Compounds: (D:) DNA polymerase gamma subunit 2

SCOP Domain Sequences for d2g4cd2:

Sequence, based on SEQRES records: (download)

>d2g4cd2 d.104.1.1 (D:67-355) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqvf
pvdalhhkpgpllpgdsafrlvsaetlreilqdkelskeqlvtflenvlktsgklrenll
hgalehyvncldlvnkrlpyglaqigvcfhpvfdtkqirngvksigekteaslvwftppr
tsnqwldfwlrhrlqwwrkfamspsnfsssdcqdeegrkgnklyynfpwgkelietlwnl
gdhellhmypgnvsklhgrdgrknvvpcvlsvngdldrgmlaylydsfq

Sequence, based on observed residues (ATOM records): (download)

>d2g4cd2 d.104.1.1 (D:67-355) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ealleicqrrhflsgskqqlsrdsllsgchpgfgplgvelrknlaaewwtsvvvfreqvf
pvdalhhkpgpllpgdsafrlvsaetlreilqdkelskeqlvtflenvlktsgklrenll
hgalehyvncldlvnkrlpyglaqigvcfhpvksigekteaslvwftpprtsnqwldfwl
rhrlqwwrkfamspsnfsssdcqdeegrkgnklyynfpwgkelietlwnlgdhellhmyp
gnvsklhgrdgrknvvpcvlsvngdldrgmlaylydsfq

SCOP Domain Coordinates for d2g4cd2:

Click to download the PDB-style file with coordinates for d2g4cd2.
(The format of our PDB-style files is described here.)

Timeline for d2g4cd2: