Lineage for d2g3ke1 (2g3k E:148-241)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765999Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (1 family) (S)
  5. 766000Family a.24.28.1: VPS28 C-terminal domain-like [140428] (1 protein)
    C-terminal part of Pfam PF03997
  6. 766001Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species)
  7. 766002Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (3 PDB entries)
    Uniprot Q02767 148-241
  8. 766010Domain d2g3ke1: 2g3k E:148-241 [134566]
    automatically matched to 2G3K A:148-241

Details for d2g3ke1

PDB Entry: 2g3k (more details), 3.05 Å

PDB Description: Crystal structure of the C-terminal domain of Vps28
PDB Compounds: (E:) vacuolar protein sorting-associated protein vps28

SCOP Domain Sequences for d2g3ke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3ke1 a.24.28.1 (E:148-241) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall

SCOP Domain Coordinates for d2g3ke1:

Click to download the PDB-style file with coordinates for d2g3ke1.
(The format of our PDB-style files is described here.)

Timeline for d2g3ke1: