PDB entry 2g3k

View 2g3k on RCSB PDB site
Description: Crystal structure of the C-terminal domain of Vps28
Class: transport protein
Keywords: 4 helix bundle
Deposited on 2006-02-20, released 2006-06-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.216
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3ka1
• Chain 'B':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3kb1
• Chain 'C':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3kc1
• Chain 'D':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3kd1
• Chain 'E':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3ke1
• Chain 'F':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3kf1
• Chain 'G':
  Compound: vacuolar protein sorting-associated protein vps28
  Species: Saccharomyces cerevisiae
  Gene: VPS28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02767 (0-93)
    • modified residue (16)
  Domains in SCOP 1.75: d2g3kg1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kA (A:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kB (B:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kC (C:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kD (D:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kE (E:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kF (F:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g3kG (G:)
  fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
  rinklsigdtltetqirellfdlelayksfyall