SCOPe 2.01: Domain d2fypb_: 2fyp B:

Lineage for d2fypb_ (2fyp B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [103225] (22 PDB entries)
   Uniprot P41148 76-285; Endoplasmin, GRP94

8. Domain d2fypb_: 2fyp B: [134388]
   automated match to d1u2oa_
   complexed with 1pe, pg4, rde

Details for d2fypb_

PDB Entry: 2fyp, 1.95 Å

PDB Description: grp94 in complex with the novel hsp90 inhibitor radester amine

PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d2fypb_:

Sequence, based on SEQRES records:

>d2fypb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records):

>d2fypb_ d.122.1.1 (B:) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

Timeline for d2fypb_:

• d2fypb_ first appeared in SCOP 1.73, called d2fypb1
  
• d2fypb_ was called d2fypb1 in SCOP 1.75
  
• d2fypb_ appears in SCOPe 2.02
  
• d2fypb_ appears in the current release, SCOPe 2.08, called d2fypb2