Lineage for d2fypb2 (2fyp B:69-337)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537079Protein HSP90 [55876] (3 species)
  7. 2537121Species Dog (Canis familiaris) [TaxId:9615] [103225] (35 PDB entries)
    Uniprot P41148 76-285; Endoplasmin, GRP94
  8. 2537139Domain d2fypb2: 2fyp B:69-337 [134388]
    Other proteins in same PDB: d2fypa3, d2fypb3
    automated match to d1u2oa_
    complexed with 1pe, pg4, rde

Details for d2fypb2

PDB Entry: 2fyp (more details), 1.95 Å

PDB Description: grp94 in complex with the novel hsp90 inhibitor radester amine
PDB Compounds: (B:) Endoplasmin

SCOPe Domain Sequences for d2fypb2:

Sequence, based on SEQRES records: (download)

>d2fypb2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d2fypb2 d.122.1.1 (B:69-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
lreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalag
neeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqst
seligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttit
lvlkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn

SCOPe Domain Coordinates for d2fypb2:

Click to download the PDB-style file with coordinates for d2fypb2.
(The format of our PDB-style files is described here.)

Timeline for d2fypb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fypb3