| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
| Protein Enolase [51606] (9 species) Fold of this protein slightly differs from common fold in topology |
| Species Escherichia coli [TaxId:562] [69396] (2 PDB entries) |
| Domain d2fymf1: 2fym F:140-431 [134385] Other proteins in same PDB: d2fyma2, d2fymc2, d2fymd2, d2fymf2 automatically matched to d1e9id1 protein/RNA complex; complexed with mg |
PDB Entry: 2fym (more details), 1.6 Å
SCOPe Domain Sequences for d2fymf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fymf1 c.1.11.1 (F:140-431) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa
Timeline for d2fymf1: