Lineage for d2fymd1 (2fym D:140-430)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343756Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1343757Protein Enolase [51606] (9 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1343789Species Escherichia coli [TaxId:562] [69396] (2 PDB entries)
  8. 1343792Domain d2fymd1: 2fym D:140-430 [134383]
    Other proteins in same PDB: d2fyma2, d2fymc2, d2fymd2, d2fymf2
    automatically matched to d1e9id1
    protein/RNA complex; complexed with mg

Details for d2fymd1

PDB Entry: 2fym (more details), 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d2fymd1:

Sequence, based on SEQRES records: (download)

>d2fymd1 c.1.11.1 (D:140-430) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

Sequence, based on observed residues (ATOM records): (download)

>d2fymd1 c.1.11.1 (D:140-430) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
ankaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtn
tkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedatiadl
avgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

SCOPe Domain Coordinates for d2fymd1:

Click to download the PDB-style file with coordinates for d2fymd1.
(The format of our PDB-style files is described here.)

Timeline for d2fymd1: