Lineage for d2fymc2 (2fym C:1-139)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412715Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1412760Protein Enolase [54828] (9 species)
  7. 1412792Species Escherichia coli [TaxId:562] [69710] (2 PDB entries)
  8. 1412794Domain d2fymc2: 2fym C:1-139 [134382]
    Other proteins in same PDB: d2fyma1, d2fymc1, d2fymd1, d2fymf1
    automatically matched to d1e9ia2
    protein/RNA complex; complexed with mg

Details for d2fymc2

PDB Entry: 2fym (more details), 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d2fymc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fymc2 d.54.1.1 (C:1-139) Enolase {Escherichia coli [TaxId: 562]}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

SCOPe Domain Coordinates for d2fymc2:

Click to download the PDB-style file with coordinates for d2fymc2.
(The format of our PDB-style files is described here.)

Timeline for d2fymc2: