SCOPe 2.04: Domain d2fxfb_: 2fxf B:

Lineage for d2fxfb_ (2fxf B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Diamine acetyltransferase 1 [143652] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries)
   Uniprot P21673 2-170! Uniprot P21673 3-169

8. Domain d2fxfb_: 2fxf B: [134309]
   automated match to d2b3ua1
   complexed with aco, act, ca

Details for d2fxfb_

PDB Entry: 2fxf, 2 Å

PDB Description: human spermidine/spermine n1-acetyltransferase

PDB Compounds: (B:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2fxfb_:

Sequence, based on SEQRES records:

>d2fxfb_ d.108.1.1 (B:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee

Sequence, based on observed residues (ATOM records):

>d2fxfb_ d.108.1.1 (B:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeyqviltekdlledgfgehpfyhclvaevpkehw
tpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcss
mhflvaewnepsinfykrrgasdlegwrlfkidkeyllkmatee

Timeline for d2fxfb_:

• d2fxfb_ first appeared in SCOP 1.73, called d2fxfb1
  
• d2fxfb_ appears in SCOPe 2.03
  
• d2fxfb_ appears in SCOPe 2.05
  
• d2fxfb_ appears in the current release, SCOPe 2.08