Lineage for d2fxfb1 (2fxf B:3-169)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731033Protein Diamine acetyltransferase 1 [143652] (1 species)
  7. 731034Species Human (Homo sapiens) [TaxId:9606] [143653] (10 PDB entries)
  8. 731047Domain d2fxfb1: 2fxf B:3-169 [134309]
    automatically matched to 2F5I A:3-169
    complexed with aco, act, ca

Details for d2fxfb1

PDB Entry: 2fxf (more details), 2 Å

PDB Description: human spermidine/spermine n1-acetyltransferase
PDB Compounds: (B:) Diamine acetyltransferase 1

SCOP Domain Sequences for d2fxfb1:

Sequence, based on SEQRES records: (download)

>d2fxfb1 d.108.1.1 (B:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmat

Sequence, based on observed residues (ATOM records): (download)

>d2fxfb1 d.108.1.1 (B:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
kfvirpataadcsdilrlikelakyeyqviltekdlledgfgehpfyhclvaevpkehwt
peghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssm
hflvaewnepsinfykrrgasdlegwrlfkidkeyllkmat

SCOP Domain Coordinates for d2fxfb1:

Click to download the PDB-style file with coordinates for d2fxfb1.
(The format of our PDB-style files is described here.)

Timeline for d2fxfb1: