SCOP 1.73: Domain d2fx8n2: 2fx8 N:108-213

Lineage for d2fx8n2 (2fx8 N:108-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2fx8n2: 2fx8 N:108-213 [134293]
   Other proteins in same PDB: d2fx8h1, d2fx8h2, d2fx8i1, d2fx8i2, d2fx8j1, d2fx8j2, d2fx8k1, d2fx8k2, d2fx8l1, d2fx8m1, d2fx8n1, d2fx8o1
   automatically matched to d1rhha2
   mutant

Details for d2fx8n2

PDB Entry: 2fx8, 2.2 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41

PDB Compounds: (N:) Fab 4E10

SCOP Domain Sequences for d2fx8n2:

Sequence; same for both SEQRES and ATOM records:

>d2fx8n2 b.1.1.2 (N:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d2fx8n2:

• d2fx8n2 is new in SCOP 1.73
  
• d2fx8n2 appears in SCOP 1.75
  
• d2fx8n2 appears in the current release, SCOPe 2.08