![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d2fx8m2: 2fx8 M:108-213 [134291] Other proteins in same PDB: d2fx8h1, d2fx8h2, d2fx8i1, d2fx8i2, d2fx8j1, d2fx8j2, d2fx8k1, d2fx8k2, d2fx8l1, d2fx8m1, d2fx8n1, d2fx8o1 automatically matched to d1rhha2 mutant |
PDB Entry: 2fx8 (more details), 2.2 Å
SCOP Domain Sequences for d2fx8m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx8m2 b.1.1.2 (M:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d2fx8m2: