Lineage for d2fx8h2 (2fx8 H:114-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655180Domain d2fx8h2: 2fx8 H:114-227 [134281]
    Other proteins in same PDB: d2fx8h1, d2fx8i1, d2fx8j1, d2fx8k1, d2fx8l1, d2fx8l2, d2fx8m1, d2fx8m2, d2fx8n1, d2fx8n2, d2fx8o1, d2fx8o2
    automatically matched to d1ngzb2
    mutant

Details for d2fx8h2

PDB Entry: 2fx8 (more details), 2.2 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41
PDB Compounds: (H:) Fab 4E10

SCOP Domain Sequences for d2fx8h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx8h2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d2fx8h2:

Click to download the PDB-style file with coordinates for d2fx8h2.
(The format of our PDB-style files is described here.)

Timeline for d2fx8h2: