SCOPe 2.08: Domain d2fx8j1: 2fx8 J:1-113

Lineage for d2fx8j1 (2fx8 J:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d2fx8j1: 2fx8 J:1-113 [134284]
   Other proteins in same PDB: d2fx8h2, d2fx8i2, d2fx8j2, d2fx8k2, d2fx8l1, d2fx8l2, d2fx8m1, d2fx8m2, d2fx8n1, d2fx8n2, d2fx8o1, d2fx8o2
   automatically matched to d1hzhh1

Details for d2fx8j1

PDB Entry: 2fx8, 2.2 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41

PDB Compounds: (J:) Fab 4E10

SCOPe Domain Sequences for d2fx8j1:

Sequence; same for both SEQRES and ATOM records:

>d2fx8j1 b.1.1.1 (J:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny
aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg
tlvtvss

Timeline for d2fx8j1:

• d2fx8j1 first appeared in SCOP 1.73
  
• d2fx8j1 appears in SCOPe 2.07