SCOPe 2.08: Domain d2fx8k2: 2fx8 K:114-227

Lineage for d2fx8k2 (2fx8 K:114-227)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2fx8k2: 2fx8 K:114-227 [134287]
   Other proteins in same PDB: d2fx8h1, d2fx8i1, d2fx8j1, d2fx8k1, d2fx8l1, d2fx8l2, d2fx8m1, d2fx8m2, d2fx8n1, d2fx8n2, d2fx8o1, d2fx8o2
   automatically matched to d1ngzb2

Details for d2fx8k2

PDB Entry: 2fx8, 2.2 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with an aib-induced peptide encompassing the 4e10 epitope on gp41

PDB Compounds: (K:) Fab 4E10

SCOPe Domain Sequences for d2fx8k2:

Sequence; same for both SEQRES and ATOM records:

>d2fx8k2 b.1.1.2 (K:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d2fx8k2:

• d2fx8k2 first appeared in SCOP 1.73
  
• d2fx8k2 appears in SCOPe 2.07