Lineage for d2fv8a1 (2fv8 A:4-184)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846827Protein RhoB [142243] (1 species)
  7. 1846828Species Human (Homo sapiens) [TaxId:9606] [142244] (1 PDB entry)
    Uniprot P62745 4-185
  8. 1846829Domain d2fv8a1: 2fv8 A:4-184 [134199]
    complexed with gdp

Details for d2fv8a1

PDB Entry: 2fv8 (more details), 1.9 Å

PDB Description: The crystal structure of RhoB in the GDP-bound state
PDB Compounds: (A:) Rho-related GTP-binding protein RhoB

SCOPe Domain Sequences for d2fv8a1:

Sequence, based on SEQRES records: (download)

>d2fv8a1 c.37.1.8 (A:4-184) RhoB {Human (Homo sapiens) [TaxId: 9606]}
irkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlrs
dehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqkry
g

Sequence, based on observed residues (ATOM records): (download)

>d2fv8a1 c.37.1.8 (A:4-184) RhoB {Human (Homo sapiens) [TaxId: 9606]}
irkklvvvgdgacgktcllivfskdefpfenyvadievdgkqvelalwdtagqedydrlr
plsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlrsdehvrte
larmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqkryg

SCOPe Domain Coordinates for d2fv8a1:

Click to download the PDB-style file with coordinates for d2fv8a1.
(The format of our PDB-style files is described here.)

Timeline for d2fv8a1: