SCOP 1.73: Domain d2fv8a1: 2fv8 A:4-184

Lineage for d2fv8a1 (2fv8 A:4-184)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoB [142243] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142244] (1 PDB entry)

8. Domain d2fv8a1: 2fv8 A:4-184 [134199]
   complexed with gdp

Details for d2fv8a1

PDB Entry: 2fv8, 1.9 Å

PDB Description: The crystal structure of RhoB in the GDP-bound state

PDB Compounds: (A:) Rho-related GTP-binding protein RhoB

SCOP Domain Sequences for d2fv8a1:

Sequence, based on SEQRES records:

>d2fv8a1 c.37.1.8 (A:4-184) RhoB {Human (Homo sapiens) [TaxId: 9606]}
irkklvvvgdgacgktcllivfskdefpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlrs
dehvrtelarmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqkry
g

Sequence, based on observed residues (ATOM records):

>d2fv8a1 c.37.1.8 (A:4-184) RhoB {Human (Homo sapiens) [TaxId: 9606]}
irkklvvvgdgacgktcllivfskdefpfenyvadievdgkqvelalwdtagqedydrlr
plsypdtdvilmcfsvdspdslenipekwvpevkhfcpnvpiilvankkdlrsdehvrte
larmkqepvrtddgramavriqaydylecsaktkegvrevfetatraalqkryg

Timeline for d2fv8a1:

• d2fv8a1 is new in SCOP 1.73
  
• d2fv8a1 appears in SCOP 1.75
  
• d2fv8a1 appears in the current release, SCOPe 2.08