Lineage for d2fuza_ (2fuz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722252Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (2 proteins)
    Pfam PF07470
  6. 2722253Protein Unsaturated glucuronyl hydrolase [109954] (1 species)
  7. 2722254Species Bacillus sp. GL1 [TaxId:84635] [109955] (4 PDB entries)
    Uniprot Q9RC92
  8. 2722255Domain d2fuza_: 2fuz A: [134193]
    automated match to d1vd5a_
    complexed with mpd

Details for d2fuza_

PDB Entry: 2fuz (more details), 1.8 Å

PDB Description: UGL hexagonal crystal structure without glycine and DTT molecules
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d2fuza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuza_ a.102.1.7 (A:) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOPe Domain Coordinates for d2fuza_:

Click to download the PDB-style file with coordinates for d2fuza_.
(The format of our PDB-style files is described here.)

Timeline for d2fuza_: