Lineage for d2fuza1 (2fuz A:1-377)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645796Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families) (S)
  5. 645936Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (1 protein)
    Pfam PF07470
  6. 645937Protein Unsaturated glucuronyl hydrolase [109954] (1 species)
  7. 645938Species Bacillus sp. GL1 [TaxId:84635] [109955] (3 PDB entries)
  8. 645942Domain d2fuza1: 2fuz A:1-377 [134193]
    automatically matched to d1vd5a_
    complexed with mpd

Details for d2fuza1

PDB Entry: 2fuz (more details), 1.8 Å

PDB Description: UGL hexagonal crystal structure without glycine and DTT molecules
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOP Domain Sequences for d2fuza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuza1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOP Domain Coordinates for d2fuza1:

Click to download the PDB-style file with coordinates for d2fuza1.
(The format of our PDB-style files is described here.)

Timeline for d2fuza1: