Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.12: Ta0583-like [142481] (1 protein) |
Protein Hypothetical protein Ta0583 [142482] (1 species) |
Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries) Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325 |
Domain d2fska2: 2fsk A:1-164 [134028] automated match to d2fsja2 |
PDB Entry: 2fsk (more details), 2.1 Å
SCOPe Domain Sequences for d2fska2:
Sequence, based on SEQRES records: (download)
>d2fska2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]} mvvvgldvgygdtkvigvdgkriifpsrwavteteswgiggkipvlstdggqtkfiygky asgnnirvpqgdgrlaskeafpliaaalwesgihndgspvdlvigsgtplgtfdlevkaa kealenkvltvtgpegevrqfnitrlimrpqgvgaalyllnqgi
>d2fska2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]} mvvvgldvgygdtkvigvdgkriifpsrwavteteswgiggkipvlstdggqtkfiygky asgnnirvpqgdgrlaskeafpliaaalwesgipvdlvigsgtplgtfdlevkaakeale nkvltvtgpegevrqfnitrlimrpqgvgaalyllnqgi
Timeline for d2fska2: