Lineage for d2fskb1 (2fsk B:165-326)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492498Family c.55.1.12: Ta0583-like [142481] (1 protein)
  6. 2492499Protein Hypothetical protein Ta0583 [142482] (1 species)
  7. 2492500Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries)
    Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325
  8. 2492505Domain d2fskb1: 2fsk B:165-326 [134029]
    automated match to d2fsja1

Details for d2fskb1

PDB Entry: 2fsk (more details), 2.1 Å

PDB Description: Crystal structure of Ta0583, an archaeal actin homolog, SeMet data
PDB Compounds: (B:) hypothetical protein Ta0583

SCOPe Domain Sequences for d2fskb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fskb1 c.55.1.12 (B:165-326) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
ieqqpgygvvidvgsrttdvltinlmdmepvvelsfslqigvgdaisalsrkiaketgfv
vpfdlaqealshpvmfrqkqvggpevsgpiledlanriienirlnlrgevdrvtslipvg
ggsnligdrfeeiapgtlvkikpedlqfanalgyrdaaersm

SCOPe Domain Coordinates for d2fskb1:

Click to download the PDB-style file with coordinates for d2fskb1.
(The format of our PDB-style files is described here.)

Timeline for d2fskb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fskb2