Lineage for d2fsja2 (2fsj A:1-164)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492498Family c.55.1.12: Ta0583-like [142481] (1 protein)
  6. 2492499Protein Hypothetical protein Ta0583 [142482] (1 species)
  7. 2492500Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries)
    Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325
  8. 2492502Domain d2fsja2: 2fsj A:1-164 [134026]
    complexed with gol

Details for d2fsja2

PDB Entry: 2fsj (more details), 1.9 Å

PDB Description: Crystal structure of Ta0583, an archaeal actin homolog, native data
PDB Compounds: (A:) hypothetical protein Ta0583

SCOPe Domain Sequences for d2fsja2:

Sequence, based on SEQRES records: (download)

>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
mvvvgldvgygdtkvigvdgkriifpsrwavteteswgiggkipvlstdggqtkfiygky
asgnnirvpqgdgrlaskeafpliaaalwesgihndgspvdlvigsgtplgtfdlevkaa
kealenkvltvtgpegevrqfnitrlimrpqgvgaalyllnqgi

Sequence, based on observed residues (ATOM records): (download)

>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
mvvvgldvgygdtkvigvdgkriifpsrwavteteswkipvlstdggqtkfiygkyasgn
nirvpqgdgrlaskeafpliaaalwesgihnpvdlvigsgtplgtfdlevkaakealenk
vltvtgpegevrqfnitrlimrpqgvgaalyllnqgi

SCOPe Domain Coordinates for d2fsja2:

Click to download the PDB-style file with coordinates for d2fsja2.
(The format of our PDB-style files is described here.)

Timeline for d2fsja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fsja1