SCOP 1.73: Domain d2fsja2: 2fsj A:1-164

Lineage for d2fsja2 (2fsj A:1-164)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.12: Ta0583-like [142481] (1 protein)

6. Protein Hypothetical protein Ta0583 [142482] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries)

8. Domain d2fsja2: 2fsj A:1-164 [134026]
   complexed with gol

Details for d2fsja2

PDB Entry: 2fsj, 1.9 Å

PDB Description: Crystal structure of Ta0583, an archaeal actin homolog, native data

PDB Compounds: (A:) hypothetical protein Ta0583

SCOP Domain Sequences for d2fsja2:

Sequence, based on SEQRES records:

>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
mvvvgldvgygdtkvigvdgkriifpsrwavteteswgiggkipvlstdggqtkfiygky
asgnnirvpqgdgrlaskeafpliaaalwesgihndgspvdlvigsgtplgtfdlevkaa
kealenkvltvtgpegevrqfnitrlimrpqgvgaalyllnqgi

Sequence, based on observed residues (ATOM records):

>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
mvvvgldvgygdtkvigvdgkriifpsrwavteteswkipvlstdggqtkfiygkyasgn
nirvpqgdgrlaskeafpliaaalwesgihnpvdlvigsgtplgtfdlevkaakealenk
vltvtgpegevrqfnitrlimrpqgvgaalyllnqgi

Timeline for d2fsja2:

• d2fsja2 is new in SCOP 1.73
  
• d2fsja2 appears in SCOP 1.75
  
• d2fsja2 appears in the current release, SCOPe 2.08