Lineage for d2frza_ (2frz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005501Species Pseudomonas putida [TaxId:303] [186787] (9 PDB entries)
  8. 2005505Domain d2frza_: 2frz A: [134001]
    automated match to d1t87a_
    complexed with hem, k; mutant

Details for d2frza_

PDB Entry: 2frz (more details), 2.1 Å

PDB Description: Crystal Structure of Cytochrome P450cam mutant (F87W/Y96F/V247L/C334A)
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d2frza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frza_ a.104.1.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2frza_:

Click to download the PDB-style file with coordinates for d2frza_.
(The format of our PDB-style files is described here.)

Timeline for d2frza_: