Lineage for d2frzb_ (2frz B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein automated matches [190068] (12 species)
    not a true protein
  7. Species Pseudomonas putida [TaxId:303] [186787] (6 PDB entries)
  8. Domain d2frzb_: 2frz B: [134002]
    automated match to d1t87a_
    complexed with hem, k; mutant

Details for d2frzb_

PDB Entry: 2frz (more details), 2.1 Å

PDB Description: Crystal Structure of Cytochrome P450cam mutant (F87W/Y96F/V247L/C334A)
PDB Compounds: (B:) Cytochrome P450-cam

SCOPe Domain Sequences for d2frzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frzb_ a.104.1.1 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2frzb_ are not available.

Timeline for d2frzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2frza_