Lineage for d2fpof_ (2fpo F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146337Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 2146338Protein Methylase YhhF [142620] (1 species)
  7. 2146339Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)
    Uniprot P0ADX9 10-192
  8. 2146345Domain d2fpof_: 2fpo F: [133914]
    automated match to d2fpoa1
    complexed with cl, edo

Details for d2fpof_

PDB Entry: 2fpo (more details), 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.
PDB Compounds: (F:) methylase yhhF

SCOPe Domain Sequences for d2fpof_:

Sequence, based on SEQRES records: (download)

>d2fpof_ c.66.1.46 (F:) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records): (download)

>d2fpof_ c.66.1.46 (F:) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpglrpttdrvretlfnwlapvivdaqcldcfagsgalgleals
ryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrr
glleetinlledngwladealiyveseveptvpanwslhrekvagqvayrlyqreaq

SCOPe Domain Coordinates for d2fpof_:

Click to download the PDB-style file with coordinates for d2fpof_.
(The format of our PDB-style files is described here.)

Timeline for d2fpof_: