Lineage for d2fp7b1 (2fp7 B:19-170)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1129399Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1129400Protein NS3 protease [50600] (4 species)
  7. 1129435Species West Nile virus [TaxId:11082] [141386] (2 PDB entries)
    Uniprot P06935 1520-1671
  8. 1129436Domain d2fp7b1: 2fp7 B:19-170 [133899]
    complexed with NS2B cofactor

Details for d2fp7b1

PDB Entry: 2fp7 (more details), 1.68 Å

PDB Description: west nile virus ns2b/ns3protease in complex with bz-nle-lys-arg-arg-h
PDB Compounds: (B:) Serine protease NS3

SCOPe Domain Sequences for d2fp7b1:

Sequence, based on SEQRES records: (download)

>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West Nile virus [TaxId: 11082]}
ttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlc
yggpwklqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgsp
ivdkngdviglygngvimpngsyisaivqger

Sequence, based on observed residues (ATOM records): (download)

>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West Nile virus [TaxId: 11082]}
ttgvyrimtsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlcyggpw
klqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgspivdkn
gdviglygngvimpngsyisaivqger

SCOPe Domain Coordinates for d2fp7b1:

Click to download the PDB-style file with coordinates for d2fp7b1.
(The format of our PDB-style files is described here.)

Timeline for d2fp7b1: