SCOPe 2.08: Domain d2fp7b1: 2fp7 B:19-170

Lineage for d2fp7b1 (2fp7 B:19-170)

1. Root: SCOPe 2.08
2. Class b: All beta proteins [48724] (180 folds)
3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold
4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)
5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel
6. Protein NS3 protease [50600] (5 species)
7. Species West Nile virus [TaxId:11082] [141386] (2 PDB entries)
   Uniprot P06935 1520-1671
8. Domain d2fp7b1: 2fp7 B:19-170 [133899]
   Other proteins in same PDB: d2fp7a1, d2fp7a2
   complexed with NS2B cofactor

Details for d2fp7b1

PDB Entry: 2fp7, 1.6800000000000002 Å

PDB Description: west nile virus ns2b/ns3protease in complex with bz-nle-lys-arg-arg-h

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d2fp7b1:

Sequence, based on SEQRES records:

>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West Nile virus [TaxId: 11082]}
ttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlc
yggpwklqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgsp
ivdkngdviglygngvimpngsyisaivqger

Sequence, based on observed residues (ATOM records):

>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West Nile virus [TaxId: 11082]}
ttgvyrimtsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlcyggpw
klqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgspivdkn
gdviglygngvimpngsyisaivqger

SCOPe Domain Coordinates for d2fp7b1 are not available.

Timeline for d2fp7b1:

• d2fp7b1 first appeared in SCOP 1.73
  
• d2fp7b1 appears in SCOPe 2.07