![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein NS3 protease [50600] (5 species) |
![]() | Species West Nile virus [TaxId:11082] [141386] (2 PDB entries) Uniprot P06935 1520-1671 |
![]() | Domain d2fp7b1: 2fp7 B:19-170 [133899] Other proteins in same PDB: d2fp7a1, d2fp7a2 complexed with NS2B cofactor |
PDB Entry: 2fp7 (more details), 1.68 Å
SCOPe Domain Sequences for d2fp7b1:
Sequence, based on SEQRES records: (download)
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West Nile virus [TaxId: 11082]} ttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlc yggpwklqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgsp ivdkngdviglygngvimpngsyisaivqger
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West Nile virus [TaxId: 11082]} ttgvyrimtsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlcyggpw klqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgspivdkn gdviglygngvimpngsyisaivqger
Timeline for d2fp7b1: